Structure of PDB 8b8f Chain A

Receptor sequence

>8b8fA (length=151) Species: 1035139 (Laccaria bicolor S238N-H53) [Search protein sequence]

SNEYNPPLGIAFRLCGLASDRVLFSRVSPSPEVFHHPKSEVYPDQWFVAI
PGSGQNAGCYAIKSKNTGKVLFSRMSPDPRVGHIDGDGKYPDNWFKFEAG
SGKYAGYFRLRAVASDTVLVSRTSTGTDTQVINYPATSAKYDDQYFTILF
D

3D structure

PDB

8b8f Atomic crystal structure and sugar specificity of a beta-trefoil lectin domain from the ectomycorrhizal basidiomycete Laccaria bicolor.

Chain

Resolution

1.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GAL	A	V121 R123 Y135 Y142 D144 Q145	V120 R122 Y134 Y141 D143 Q144
BS02	GAL	A	F73 R75 I85 Y91 D93	F72 R74 I84 Y90 D92
BS03	GAL	A	F25 R27 H37 Y43 D45	F24 R26 H36 Y42 D44
BS04	GAL	A	F73 R75 I85 Y91 D93	F72 R74 I84 Y90 D92
BS05	GAL	A	V121 R123 Y135 Y142 D144 Q145	V120 R122 Y134 Y141 D143 Q144
BS06	GAL	A	F25 R27 H37 Y43 D45 Q46	F24 R26 H36 Y42 D44 Q45

External links

PDB	RCSB:8b8f, PDBe:8b8f, PDBj:8b8f
PDBsum	8b8f
PubMed	36754262
UniProt	B0D650

[Back to BioLiP]