Structure of PDB 8b2h Chain A |
>8b2hA (length=143) Species: 2587410 (Thermothielavioides terrestris) [Search protein sequence] |
GNLPGLNSVQSSHARAIIGEAKKEGVGRHGCEAGIATALVESNILIYANK AVPASLKYPHDAVGSDHDSVGIFQQRAKYYPNIAADMDPARSAAQFFAKM KGIKGWQSMAVGTLCQKVQGSAYPDRYAKRVSEATKICQAGGL |
|
PDB | 8b2h Module walking using an SH3-like cell-wall-binding domain leads to a new GH184 family of muramidases. |
Chain | A |
Resolution | 2.36 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H113 E116 |
H29 E32 |
|
|
|
|