Structure of PDB 8ass Chain A

Receptor sequence
>8assA (length=117) Species: 1523420 (Rhizobium sp. AAP43) [Search protein sequence]
DFDLSGTSTTWVNELGSVMTIDVDRKGGVTGYYVNNAPGTGCRGLPYDLS
GHAHGSTIAFSVVWSNGIADCRSATSWAGYARKTFGGVQIVTQWSLAFVG
KAGGKIETGQNVFTYQA
3D structure
PDB8ass Self-assembly of a dimeric avidin into unique higher-order oligomers.
ChainA
Resolution2.12 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BTN A L28 S30 Y46 N48 A50 G54 W77 S86 T88 W108 L15 S17 Y33 N35 A37 G41 W64 S73 T75 W94
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Dec 19 06:34:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ass', asym_id = 'A', title = 'Self-assembly of a dimeric avidin into unique higher-order oligomers.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ass', asym_id='A', title='Self-assembly of a dimeric avidin into unique higher-order oligomers.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009374', uniprot = '', pdbid = '8ass', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009374', uniprot='', pdbid='8ass', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>