Structure of PDB 8amu Chain A

Receptor sequence
>8amuA (length=131) Species: 1311 (Streptococcus agalactiae) [Search protein sequence]
AKEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKY
KKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLT
HESKDAIAKKKHVYDKADIKLINNFDIDRYV
3D structure
PDB8amu Structures of pMV158 replication initiator RepB with and without DNA reveal a flexible dual-function protein.
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K3 D69 R72 K76 M86 V87 Q88 K2 D68 R71 K75 M85 V86 Q87
BS02 dna A K3 V66 T67 D69 S70 K73 K74 K2 V65 T66 D68 S69 K72 K73
BS03 MN A H39 D42 H55 H57 H38 D41 H54 H56
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003916 DNA topoisomerase activity
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005727 extrachromosomal circular DNA

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8amu, PDBe:8amu, PDBj:8amu
PDBsum8amu
PubMed36688326
UniProtP13921|REPB_STRAG Replication protein RepB (Gene Name=repB)

[Back to BioLiP]