Structure of PDB 8alz Chain A

Receptor sequence
>8alzA (length=258) Species: 9606 (Homo sapiens) [Search protein sequence]
RHPCDCLGQKHKLINNCLICGRIVCEQEGSGPCLFCGTLVCTHEEQDILQ
RDPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRI
QDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAAT
AKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQF
KEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKK
GLMKQNKA
3D structure
PDB8alz Cryo-EM structure of ASCC3 in complex with ASC1
ChainA
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C171 C173 H178 C192 C4 C6 H11 C25
BS02 ZN A C184 C187 C203 C17 C20 C36
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016922 nuclear receptor binding
GO:0019901 protein kinase binding
GO:0030331 nuclear estrogen receptor binding
GO:0035035 histone acetyltransferase binding
GO:0044389 ubiquitin-like protein ligase binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0030520 estrogen receptor signaling pathway
GO:0032790 ribosome disassembly
GO:0045661 regulation of myoblast differentiation
GO:0045893 positive regulation of DNA-templated transcription
GO:0072344 rescue of stalled ribosome
GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0016604 nuclear body
GO:0031594 neuromuscular junction
GO:0032991 protein-containing complex
GO:0099053 activating signal cointegrator 1 complex
GO:0180022 RQC-trigger complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8alz, PDBe:8alz, PDBj:8alz
PDBsum8alz
PubMed
UniProtQ15650|TRIP4_HUMAN Activating signal cointegrator 1 (Gene Name=TRIP4)

[Back to BioLiP]