Structure of PDB 8aka Chain A

Receptor sequence

>8akaA (length=282) Species: 9606 (Homo sapiens)

PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTAS
GIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRF
LVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGL
KATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTS
LQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLM
KHLGLEIPAWDGPRVLERALPPLPRPPTPKLE

3D structure

• PDB: 8aka Development of novel Sirtuin 6 inhibitors and activators based on a protein crystallography-based fragment screen
• Chain: A
• Resolution: 1.77 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.286: protein acetyllysine N-acetyltransferase.
  2.4.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AR6	A	G52 A53 G54 T57 D63 F64 R65 Q113 H133 G214 T215 S216 I219 N240 L241 Q242 Y257 V258	G43 A44 G45 T48 D54 F55 R56 Q104 H124 G198 T199 S200 I203 N224 L225 Q226 Y241 V242
BS02	ZN	A	C141 C144 C166 C177	C132 C135 C157 C161
BS03	STL	A	P62 F64 F82 F86 V115 I185	P53 F55 F73 F77 V106 I169

Gene Ontology

Molecular Function

• GO:0070403 NAD+ binding

External links

• PDB: RCSB:8aka, PDBe:8aka, PDBj:8aka
• PDBsum: 8aka
• UniProt: Q8N6T7|SIR6_HUMAN NAD-dependent protein deacylase sirtuin-6 (Gene Name=SIRT6)