Structure of PDB 8ai5 Chain A

Receptor sequence

>8ai5A (length=316) Species: 1423 (Bacillus subtilis)

YNKTVSINLDSRCNASCDHCCFSSSPTSTTRMEKEYIRELVTEFAKNKTI
QVISFTGGEVFLDYKFLKELMEIIKPYEKQITLISNGFWGLSKKKVQEYF
HDMNSLNVIALTISYDEYHAPFVKSSSIKNILEHSRKYPDIDISLNMAVT
KDKMSNHILEELGDSILGVKITKFPMISVGAAKTRIKQENIHKFYSLEDE
DSLHCPGYDIVYHHDGEIYPCASPAIFETKITLREEYNQSFERTVEKLNS
NLLLFILRKEGFKWFLNILKENNKIEEFDIPYEFSSICGVCGSLFNSAEK
INYFYPYMEKYYNENF

3D structure

• PDB: 8ai5 Structural and mechanistic basis for RiPP epimerization by a radical SAM enzyme.
• Chain: A
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	S7 T57 T83 I85 A111 T113 D143 I144 K171 F175 I178 P207 G208 D210 A223 S224 P225 F228 C289	S6 T56 T82 I84 A110 T112 D142 I143 K170 F174 I177 P206 G207 D209 A222 S223 P224 F227 C288
BS02	SF4	A	C14 A16 C18 C21 S25 G59 N87 H120	C13 A15 C17 C20 S24 G58 N86 H119
BS03	SF4	A	C206 C222 S224 F263 C289 C292	C205 C221 S223 F262 C288 C291
BS04	SAH	A	H20 C21 C22 G58 G59 I85 S115 H120 I178	H19 C20 C21 G57 G58 I84 S114 H119 I177

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:8ai5, PDBe:8ai5, PDBj:8ai5
• PDBsum: 8ai5
• PubMed: 38158457
• UniProt: Q45595|YYDG_BACSU Putative peptide biosynthesis protein YydG (Gene Name=yydG)