Structure of PDB 8ai2 Chain A

Receptor sequence

>8ai2A (length=317) Species: 1423 (Bacillus subtilis)

MYNKTVSINLDSRCNASCDHCCFSSSPTSTTRMEKEYIRELVTEFAKNKT
IQVISFTGGEVFLDYKFLKELMEIIKPYEKQITLISNGFWGLSKKKVQEY
FHDMNSLNVIALTISYDEYHAPFVKSSSIKNILEHSRKYPDIDISLNMAV
TKDKMSNHILEELGDSILGVKITKFPMISVGAAKTRIKQENIHKFYSLED
EDSLHCPGYDIVYHHDGEIYPCCSPAIFETKITLREEYNQSFERTVEKLN
SNLLLFILRKEGFKWFLNILKENNKIEEFDIPYEFSSICGVCGSLFNSAE
KINYFYPYMEKYYNENF

3D structure

• PDB: 8ai2 Structural and mechanistic basis for RiPP epimerization by a radical SAM enzyme.
• Chain: A
• Resolution: 2.393 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	S7 T57 I85 F175 I178 P207 G208 D210 C223 S224 P225 F228	S7 T57 I85 F175 I178 P207 G208 D210 C223 S224 P225 F228
BS02	SF4	A	C14 A16 C18 C21 S25 G59 N87 H120	C14 A16 C18 C21 S25 G59 N87 H120
BS03	SF4	A	C206 P207 C222 S224 F263 C289 C292	C206 P207 C222 S224 F263 C289 C292
BS04	SAH	A	H20 C21 C22 G58 G59 I85 S115 H120 I178	H20 C21 C22 G58 G59 I85 S115 H120 I178

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:8ai2, PDBe:8ai2, PDBj:8ai2
• PDBsum: 8ai2
• PubMed: 38158457
• UniProt: Q45595|YYDG_BACSU Putative peptide biosynthesis protein YydG (Gene Name=yydG)