Structure of PDB 8ad5 Chain A

Receptor sequence

>8ad5A (length=278) Species: 666 (Vibrio cholerae)

GPVKKWECTVISNDNKATFIKELKLAIPDGESVPFRAGGYIQIEAPAHHV
KYADFDVPEKYRGDWDKFNLFRYESKVDEPIIRAYSMANYPEEFGIIMLN
VRIATPPPNNPNVPPGQMSSYIWSLKAGDKCTISGPFGEFFAKDTDAEMV
FIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGARSKREMFYVEDFDGLA
AENDNFVWHCALSDPQPEDNWTGYTGFIHNVLYENYLKDHEAPEDCEYYM
CGPPMMNAAVINMLKNLGVEEENILLDD

3D structure

• PDB: 8ad5 Conformational coupling of redox-driven Na + -translocation in Vibrio cholerae NADH:quinone oxidoreductase.
• Chain: A
• Resolution: 1.65 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	Y167 R210 A211 Y212 S213 R229 A231 V240 P241 P242 G243 Q244 M245 S246	Y40 R83 A84 Y85 S86 R102 A104 V113 P114 P115 G116 Q117 M118 S119
BS02	NA	A	A327 N330 D331 F333	A200 N203 D204 F206
BS03	NAI	A	S213 R229 G281 G282 A283 G284 G310 A311 S340 F354 C378 P380 M382 M383 D404	S86 R102 G154 G155 A156 G157 G183 A184 S213 F227 C251 P253 M255 M256 D277

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006814 sodium ion transport

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8ad5, PDBe:8ad5, PDBj:8ad5
• PDBsum: 8ad5
• PubMed: 37710014
• UniProt: A5F5Y4|NQRF_VIBC3 Na(+)-translocating NADH-quinone reductase subunit F (Gene Name=nqrF)