Structure of PDB 8ad4 Chain A

Receptor sequence

>8ad4A (length=279) Species: 666 (Vibrio cholerae)

MVKKWECTVISNDNKATFIKELKLAIPDGESVPFRAGGYIQIEAPAHHVK
YADFDVPEKYRGDWDKFNLFRYESKVDEPIIRAYSMANYPEEFGIIMLNV
RIATPPPNNPNVPPGQMSSYIWSLKAGDKCTISGPFGEFFAKDTDAEMVF
IGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGARSKREMFYVEDFDGLAA
ENDNFVWHCALSDPQPEDNWTGYTGFIHNVLYENYLKDHEAPEDCEYYMC
GPPMMNAAVINMLKNLGVEEENILLDDFG

3D structure

• PDB: 8ad4 Conformational coupling of redox-driven Na + -translocation in Vibrio cholerae NADH:quinone oxidoreductase.
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	Y167 R210 A211 Y212 S213 N227 A231 V240 P241 P242 G243 Q244 M245 S246 F406	Y39 R82 A83 Y84 S85 N99 A103 V112 P113 P114 G115 Q116 M117 S118 F278
BS02	NAI	A	R229 G282 A283 G284 G310 A311 R312 S340 F354 G379 P380 P381 M382 F406	R101 G154 A155 G156 G182 A183 R184 S212 F226 G251 P252 P253 M254 F278
BS03	NAI	A	F146 K194 F195 R229 T232 P235	F18 K66 F67 R101 T104 P107
BS04	NA	A	K143 A144 Y188 R315 E316 M317	K15 A16 Y60 R187 E188 M189
BS05	NA	A	A327 N330 D331 F333	A199 N202 D203 F205

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006814 sodium ion transport

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8ad4, PDBe:8ad4, PDBj:8ad4
• PDBsum: 8ad4
• PubMed: 37710014
• UniProt: A5F5Y4|NQRF_VIBC3 Na(+)-translocating NADH-quinone reductase subunit F (Gene Name=nqrF)