Structure of PDB 8abo Chain A

Receptor sequence

>8aboA (length=391) Species: 1279 (Staphylococcus)

KVYNSIFDQAYEIDPIPYFNFLRKHDPVHYEESIDAYFVSKYKDVKYILK
NNDIFNTKTLAKRAEPVMKDRVLAQMSGQEHKSKKKAILKGMTGKYLENL
MPILEKRTNDIINKHIEKKEIDIVNDFGKVFAVQSSMDLLGINLENYEKI
REWHNGIAKFITSFNLNDEEIKYSLECSDKLENYLMPLIKDRKKSTKDDL
ISILLEYKNDENSISDTEILALSLNVLLAATEPVDKTLAYLFYNLLKNPE
QFESVKNNPKLIKNAIIETLRYNSPVQLIPRQVSKPFIFNNTELQAGDTV
ICMIGSANRDPEAYSNPDEFNIHRSSTSHSQNLSFGTGVHTCVGASFSLI
QLEMVAILLLKRLKNIKLKTMEITEHGIYTRGPKSMVISFD

3D structure

• PDB: 8abo Crystal structure of a staphylococcal orthologue of CYP134A1 (CYPX) in complex with a fragment
• Chain: A
• Resolution: 1.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	231	A	T164 A231 P235 Y387	T162 A229 P233 Y379
BS02	HEM	A	L75 A76 H83 K87 A231 A232 P235 I281 R283 S342 F343 H348 C350 V351 G352 S356	L73 A74 H81 K85 A229 A230 P233 I279 R281 S334 F335 H340 C342 V343 G344 S348

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 18:41:02 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8abo', asym_id = 'A', title = 'Crystal structure of a staphylococcal orthologue of CYP134A1 (CYPX) in complex with a fragment'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8abo', asym_id='A', title='Crystal structure of a staphylococcal orthologue of CYP134A1 (CYPX) in complex with a fragment')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004497,0005506,0016705,0020037,0046148', uniprot = '', pdbid = '8abo', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004497,0005506,0016705,0020037,0046148', uniprot='', pdbid='8abo', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>