Structure of PDB 8aan Chain A

Receptor sequence

>8aanA (length=228) Species: 562 (Escherichia coli) [Search protein sequence]

TAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGI
CEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAH
SPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLC
QYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRT
PMRLSYIEKKKGRQTTHIVFSFRDITSM

3D structure

PDB

8aan Rep protein accommodates together dsDNA and ssDNA which enables a loop-back mechanism to plasmid DNA replication initiation.

Chain

Resolution

2.19 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	R33 R200 M201 P202 R205 R206 R233 Q234	R30 R180 M181 P182 R185 R186 R213 Q214
BS02	dna	A	S75 S79 K80 R83 R124 G125 Y127 N159 P195 Q196 S197 Y198 D203 R207	S66 S70 K71 R74 R104 G105 Y107 N139 P175 Q176 S177 Y178 D183 R187
BS03	dna	A	R17 N22 Q143 N144 R145 F146 Q148 Q171 Y172 I180 V181	R14 N19 Q123 N124 R125 F126 Q128 Q151 Y152 I160 V161
BS04	MG	A	E77 D81	E68 D72

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8aan, PDBe:8aan, PDBj:8aan
PDBsum	8aan
PubMed	37713613
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]