Structure of PDB 8a1q Chain A |
>8a1qA (length=57) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
QNFRVYYRDSRDPVWKGPAKLLEKGEGAVVIQDNSDIKVVPRRKAKIIRD YGKQMAG |
|
PDB | 8a1q The Drug-Induced Interface That Drives HIV-1 Integrase Hypermultimerization and Loss of Function. |
Chain | A |
Resolution | 2.06 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
WBV |
A |
W235 K266 |
W15 K46 |
|
|
|
|