Structure of PDB 7zyc Chain A |
>7zycA (length=111) Species: 483216 (Bacteroides eggerthii DSM 20697) [Search protein sequence] |
TCSKVFLLENEISWEQVGEGIQRQILGYDGQLMLVKVKFQKGAIGNAHEH FHSQSTYVVSGVFEFHVNGEKKIVKAGDGIYMEPDVLHGCTCLEAGILID TFSPMREDFIN |
|
PDB | 7zyc BeKdgF with Ca |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H50 H52 Q56 H90 |
H48 H50 Q54 H88 |
|
|
|
|