Structure of PDB 7zxy Chain A

Receptor sequence

>7zxyA (length=220) Species: 1148 (Synechocystis sp. PCC 6803)

SKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTCFL
IQFATGFAMTFYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMMVL
MMILHVFRVYLTGGFKKPRELTWVVGVMLAVTTVTFGVTGYSLPWDQVGY
WAVKIVSGVPAAIPVVGDQLVTLMRGSESVGQATLTRFYSLHTFVLPWAI
AVLLLLHFLMIRKQGISGPL

3D structure

• PDB: 7zxy Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
• Chain: A
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	V37 I39 F40	V35 I37 F38
BS02	ECH	A	I39 F40 L46 M103	I37 F38 L44 M101
BS03	HEM	A	Q54 F55 G58 M61 R90 H93 R94 A97 M100 F138 G142 L145 H194 T195 P199	Q52 F53 G56 M59 R88 H91 R92 A95 M98 F136 G140 L143 H192 T193 P197
BS04	HEM	A	Y41 G44 T47 L48 M104 H107 V108 R110 V111 G116 T124 W125 G128 L206 H209 I213 I218 S219	Y39 G42 T45 L46 M102 H105 V106 R108 V109 G114 T122 W123 G126 L204 H207 I211 I216 S217
BS05	HEC	A	V37 Y41 C42 G45 L48 F210 R214 G217	V35 Y39 C40 G43 L46 F208 R212 G215
BS06	CLA	A	I105 Y112	I103 Y110

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009512 cytochrome b6f complex
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7zxy, PDBe:7zxy, PDBj:7zxy
• PDBsum: 7zxy
• PubMed: 35726684
• UniProt: Q57038|CYB6_SYNY3 Cytochrome b6 (Gene Name=petB)