Structure of PDB 7zgo Chain A

Receptor sequence
>7zgoA (length=470) Species: 9606 (Homo sapiens) [Search protein sequence]
KFGWIKGVLVRCMLNIWGVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTI
TGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGAIGLIFAFANAVAVAMY
VVGFAETVVELLKEHSILMIDEINDIRIIGAITVVILLGISVAGMEWEAK
AQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPDFRE
EETFFSVFAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVY
VGIAVSVGSCVVRDATGNVNDTIVTELTNCTSAACKLNFDFSSCESSPCS
YGLMNNFQVMSMVSGFTPLISAGIFSATLSSALASLVSAPKIFQALCKDN
IYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAELNVIAPIISNFFL
ASYALINFSVFHASLAKSPGWRPAFKYYNMWISLLGAILCCIVMFVINWW
AALLTYVIVLGLYIYVTYKK
3D structure
PDB7zgo Cryo-EM structure of the human NKCC1 transporter reveals mechanisms of ion coupling and specificity.
ChainA
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008511 sodium:potassium:chloride symporter activity
GO:0008519 ammonium channel activity
GO:0015079 potassium ion transmembrane transporter activity
GO:0015293 symporter activity
GO:0015377 chloride:monoatomic cation symporter activity
GO:0019901 protein kinase binding
GO:0022857 transmembrane transporter activity
GO:0046873 metal ion transmembrane transporter activity
GO:0051087 protein-folding chaperone binding
GO:0051879 Hsp90 protein binding
Biological Process
GO:0006811 monoatomic ion transport
GO:0006813 potassium ion transport
GO:0006814 sodium ion transport
GO:0006821 chloride transport
GO:0006883 intracellular sodium ion homeostasis
GO:0006884 cell volume homeostasis
GO:0006972 hyperosmotic response
GO:0007214 gamma-aminobutyric acid signaling pathway
GO:0010818 T cell chemotaxis
GO:0030007 intracellular potassium ion homeostasis
GO:0030321 transepithelial chloride transport
GO:0030644 intracellular chloride ion homeostasis
GO:0035633 maintenance of blood-brain barrier
GO:0035725 sodium ion transmembrane transport
GO:0035865 cellular response to potassium ion
GO:0045795 positive regulation of cell volume
GO:0055064 chloride ion homeostasis
GO:0055075 potassium ion homeostasis
GO:0055078 sodium ion homeostasis
GO:0055085 transmembrane transport
GO:0061044 negative regulation of vascular wound healing
GO:0070634 transepithelial ammonium transport
GO:0072488 ammonium transmembrane transport
GO:0098658 inorganic anion import across plasma membrane
GO:0098659 inorganic cation import across plasma membrane
GO:0098719 sodium ion import across plasma membrane
GO:0150003 regulation of spontaneous synaptic transmission
GO:0150104 transport across blood-brain barrier
GO:1902476 chloride transmembrane transport
GO:1904450 positive regulation of aspartate secretion
GO:1904464 regulation of matrix metallopeptidase secretion
GO:1990573 potassium ion import across plasma membrane
GO:1990869 cellular response to chemokine
Cellular Component
GO:0005886 plasma membrane
GO:0009925 basal plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0016328 lateral plasma membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031253 cell projection membrane
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0044297 cell body
GO:0044298 cell body membrane
GO:0070062 extracellular exosome
GO:0071944 cell periphery
GO:1903561 extracellular vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zgo, PDBe:7zgo, PDBj:7zgo
PDBsum7zgo
PubMed36239040
UniProtP55011|S12A2_HUMAN Solute carrier family 12 member 2 (Gene Name=SLC12A2)

[Back to BioLiP]