Structure of PDB 7ze6 Chain A |
>7ze6A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSHMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDA VKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIY NKPGDDIVLMAEALEKLFLQKINELPTEE |
|
PDB | 7ze6 Mapping Ligand Interactions of Bromodomains BRD4 and ATAD2 with FragLites and PepLites─Halogenated Probes of Druglike and Peptide-like Molecular Interactions. |
Chain | A |
Resolution | 1.04 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1P8 |
A |
P82 N140 |
P43 N101 |
|
|
|