Structure of PDB 7zc3 Chain A

Receptor sequence
>7zc3A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence]
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTL
LATLKKTGKTVSYLGLE
3D structure
PDB7zc3 Crystal Structure of the Human Copper Chaperone ATOX1 Bound to Zinc Ion.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C12 C15 C11 C14
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0016530 metallochaperone activity
GO:0016531 copper chaperone activity
GO:0032767 copper-dependent protein binding
GO:0046872 metal ion binding
GO:1903136 cuprous ion binding
Biological Process
GO:0006825 copper ion transport
GO:0006878 intracellular copper ion homeostasis
GO:0006979 response to oxidative stress
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zc3, PDBe:7zc3, PDBj:7zc3
PDBsum7zc3
PubMed36291703
UniProtO00244|ATOX1_HUMAN Copper transport protein ATOX1 (Gene Name=ATOX1)

[Back to BioLiP]