Structure of PDB 7zay Chain A

Receptor sequence
>7zayA (length=566) Species: 9606 (Homo sapiens) [Search protein sequence]
NSSIYKGKKCRMESCFDFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAI
EGSRFYTSDPSQACLFVLSLDTLDRDQLSPQYVHNLRSKVQSLHLWNNGR
NHLIFNLYSGTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFS
KDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHN
GEDVVLLTTCRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSFRFLEA
LQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDK
ILALRQQTQFLWEAYFSSVEKIVLTTLEIIQDRIFKHISRNSLIWNKHPG
GLFVLPQYSSYLGDFPYYYANLGLKPPSKFTAVIHVLKLLVAAAKSQYCA
QIIMSSRFLPYDNIITDAVLSLDEDTVLSTTEVDFAFTVWQSFPERIVGY
PARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYSHYLPASL
KNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQFAQRQSCMNTFASWF
GYMPLIHSQMRLDPVL
3D structure
PDB7zay Structure of the human heparan sulfate polymerase complex EXT1-EXT2.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.4.1.225: N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UDP A K269 Y271 R280 Y319 Y324 F345 R346 E349 K181 Y183 R192 Y219 Y224 F245 R246 E249
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008375 acetylglucosaminyltransferase activity
GO:0015020 glucuronosyltransferase activity
GO:0016757 glycosyltransferase activity
GO:0042328 heparan sulfate N-acetylglucosaminyltransferase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0050508 glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activity
GO:0050509 N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase activity
Biological Process
GO:0000271 polysaccharide biosynthetic process
GO:0000902 cell morphogenesis
GO:0001503 ossification
GO:0001958 endochondral ossification
GO:0001974 blood vessel remodeling
GO:0002062 chondrocyte differentiation
GO:0002067 glandular epithelial cell differentiation
GO:0002244 hematopoietic progenitor cell differentiation
GO:0002524 hypersensitivity
GO:0003128 heart field specification
GO:0003415 chondrocyte hypertrophy
GO:0003416 endochondral bone growth
GO:0006024 glycosaminoglycan biosynthetic process
GO:0006486 protein glycosylation
GO:0007033 vacuole organization
GO:0007155 cell adhesion
GO:0007166 cell surface receptor signaling pathway
GO:0007224 smoothened signaling pathway
GO:0007369 gastrulation
GO:0007411 axon guidance
GO:0007420 brain development
GO:0007492 endoderm development
GO:0007498 mesoderm development
GO:0008217 regulation of blood pressure
GO:0008283 cell population proliferation
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0009615 response to virus
GO:0009642 response to light intensity
GO:0010467 gene expression
GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway
GO:0014033 neural crest cell differentiation
GO:0015012 heparan sulfate proteoglycan biosynthetic process
GO:0015014 heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process
GO:0017145 stem cell division
GO:0019882 antigen processing and presentation
GO:0021554 optic nerve development
GO:0021772 olfactory bulb development
GO:0022405 hair cycle process
GO:0030163 protein catabolic process
GO:0030166 proteoglycan biosynthetic process
GO:0030199 collagen fibril organization
GO:0030202 heparin metabolic process
GO:0030204 chondroitin sulfate metabolic process
GO:0030210 heparin biosynthetic process
GO:0030509 BMP signaling pathway
GO:0031069 hair follicle morphogenesis
GO:0031175 neuron projection development
GO:0032836 glomerular basement membrane development
GO:0033627 cell adhesion mediated by integrin
GO:0035176 social behavior
GO:0035249 synaptic transmission, glutamatergic
GO:0035264 multicellular organism growth
GO:0035988 chondrocyte proliferation
GO:0036022 limb joint morphogenesis
GO:0036336 dendritic cell migration
GO:0036339 lymphocyte adhesion to endothelial cell of high endothelial venule
GO:0042044 fluid transport
GO:0042060 wound healing
GO:0042311 vasodilation
GO:0042596 fear response
GO:0043931 ossification involved in bone maturation
GO:0044344 cellular response to fibroblast growth factor stimulus
GO:0045165 cell fate commitment
GO:0045453 bone resorption
GO:0048598 embryonic morphogenesis
GO:0048733 sebaceous gland development
GO:0050891 multicellular organismal-level water homeostasis
GO:0050901 leukocyte tethering or rolling
GO:0051923 sulfation
GO:0055078 sodium ion homeostasis
GO:0060047 heart contraction
GO:0060070 canonical Wnt signaling pathway
GO:0060218 hematopoietic stem cell differentiation
GO:0060349 bone morphogenesis
GO:0060350 endochondral bone morphogenesis
GO:0060351 cartilage development involved in endochondral bone morphogenesis
GO:0060429 epithelium development
GO:0060441 epithelial tube branching involved in lung morphogenesis
GO:0060485 mesenchyme development
GO:0060506 smoothened signaling pathway involved in lung development
GO:0060560 developmental growth involved in morphogenesis
GO:0060792 sweat gland development
GO:0061484 hematopoietic stem cell homeostasis
GO:0061744 motor behavior
GO:0061974 perichondral bone morphogenesis
GO:0062094 stomach development
GO:0065003 protein-containing complex assembly
GO:0070593 dendrite self-avoidance
GO:0070848 response to growth factor
GO:0071503 response to heparin
GO:0071625 vocalization behavior
GO:0071711 basement membrane organization
GO:0071773 cellular response to BMP stimulus
GO:0072112 podocyte differentiation
GO:0072498 embryonic skeletal joint development
GO:0097021 lymphocyte migration into lymphoid organs
GO:0097241 hematopoietic stem cell migration to bone marrow
GO:0098586 cellular response to virus
GO:0098868 bone growth
GO:0120193 tight junction organization
GO:1901706 mesenchymal cell differentiation involved in bone development
GO:1904888 cranial skeletal system development
GO:1990823 response to leukemia inhibitory factor
Cellular Component
GO:0000139 Golgi membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0016020 membrane
GO:0045202 synapse
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zay, PDBe:7zay, PDBj:7zay
PDBsum7zay
PubMed36402845
UniProtQ16394|EXT1_HUMAN Exostosin-1 (Gene Name=EXT1)

[Back to BioLiP]