Structure of PDB 7z3b Chain A |
>7z3bA (length=139) Species: 920 (Acidithiobacillus ferrooxidans) [Search protein sequence] |
GVHHYTIDEFNYYYKPDRMTWHVGEKVELTIDNRSQSAPPIAHQFSIGRT LVSRDNGFPKSQAIAVGWKDNFFDGVPITSGGQTGPVPAFSVSLNGGQKY TFSFVVPNKPGKWEYGCFLQTGQHFMNGMHGILDILPAQ |
|
PDB | 7z3b Crystal structure of the cupredoxin AcoP from Acidithiobacillus ferrooxidans |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
H85 C159 H166 |
H43 C117 H124 |
|
|
|