Structure of PDB 7z0u Chain A

Receptor sequence
>7z0uA (length=78) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
NVSTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSC
PVKKKVQRSAEDPSLLVATYEGTHNHLG
3D structure
PDB7z0u New aspects of DNA recognition by group II WRKY transcription factor revealed by structural and functional study of AtWRKY18 DNA binding domain.
ChainA
Resolution2.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R182 K183 G185 R25 K26 G28
BS02 dna A Y184 K187 T189 R190 R196 Y198 K210 Y27 K30 T32 R33 R39 Y41 K53
BS03 ZN A C201 C207 H231 H233 C44 C50 H74 H76
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7z0u, PDBe:7z0u, PDBj:7z0u
PDBsum7z0u
PubMed35660042
UniProtQ9C5T4|WRK18_ARATH WRKY transcription factor 18 (Gene Name=WRKY18)

[Back to BioLiP]