Structure of PDB 7yzi Chain A

Receptor sequence

>7yziA (length=378) Species: 555461 (Mycobacterium tuberculosis '98-R604 INH-RIF-EM')

VARRQRVLTITAWLAVVVTGSFALMQLATGAGGWYIALINVFTAVTFAIV
PLLHRFGGLVAPLTFIGTAYVAIFAIGWDVGTDAGAQFFFLVAAALVVLL
VGIEHTALAVGLAAVAAGLVIALEFLVPPDTGLQPPWAMSVSFVLTTVSA
CGVAVATVWFALRDTARAEAVMEAEHDRSEALLANMLPASIAERLKEPER
NIIADKYDEASVLFADIVGFTERASSTAPADLVRFLDRLYSAFDELVDQH
GLEKIKVSGDSYMVVSGVPRPRPDHTQALADFALDMTNVAAQLKDPRGNP
VPLRVGLATGPVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGQIQVPD
EVYERLKDDFVLRERMRTWYLIGRKVAA

3D structure

• PDB: 7yzi Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
• Chain: A
• Resolution: 3.83 Å

Enzymatic activity

• Enzyme Commision number: 4.6.1.1: adenylate cyclase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ONM	A	F260 L272 D300 R344	F220 L232 D260 R304
BS02	MN	A	D256 I257 D300	D216 I217 D260
BS03	MN	A	D256 D300	D216 D260
BS04	ONM	A	K296 V366 W367	K256 V326 W327

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0001653 peptide receptor activity
• GO:0004016 adenylate cyclase activity
• GO:0004383 guanylate cyclase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016829 lyase activity
• GO:0016849 phosphorus-oxygen lyase activity
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006171 cAMP biosynthetic process
• GO:0006182 cGMP biosynthetic process
• GO:0007168 receptor guanylyl cyclase signaling pathway
• GO:0009190 cyclic nucleotide biosynthetic process
• GO:0035556 intracellular signal transduction

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:7yzi, PDBe:7yzi, PDBj:7yzi
• PDBsum: 7yzi
• PubMed: 35980026
• UniProt: P9WQ35|CYA1_MYCTU Adenylate cyclase (Gene Name=cya)