Structure of PDB 7yzd Chain A

Receptor sequence
>7yzdA (length=112) Species: 7955 (Danio rerio) [Search protein sequence]
YQRYPKPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFFKGNYKGW
RDSVRHNLSSYDCFVKVLKDPGKPQGKGNFWTVEVNRIPLELLKRQNTAV
SRFAQDLAPYIF
3D structure
PDB7yzd Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1.
ChainA
Resolution2.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y92 R94 L120 R146 H147 S150 K157 K168 G169 N170 W172 N188 R193 Y1 R3 L29 R55 H56 S59 K66 K77 G78 N79 W81 N97 R102
BS02 dna A Y92 Q93 R94 Y95 K97 S101 Y102 Y138 D143 S144 H147 Y152 Q166 K168 Q187 Y1 Q2 R3 Y4 K6 S10 Y11 Y47 D52 S53 H56 Y61 Q75 K77 Q96
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yzd, PDBe:7yzd, PDBj:7yzd
PDBsum7yzd
PubMed36435807
UniProtQ9I9E1|FOXH1_DANRE Forkhead box protein H1 (Gene Name=foxh1)

[Back to BioLiP]