Structure of PDB 7yz7 Chain A

Receptor sequence
>7yz7A (length=120) Species: 7955 (Danio rerio) [Search protein sequence]
KNYQRYPKPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFFKGNYK
GWRDSVRHNLSSYDCFVKVLKDPGKPQGKGNFWTVEVNRIPLELLKRQNT
AVSRQDETIFAQDLAPYIFQ
3D structure
PDB7yz7 Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1.
ChainA
Resolution0.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y92 R94 L120 R146 H147 S150 K157 K168 G169 N170 W172 N188 R193 Y3 R5 L31 R57 H58 S61 K68 K79 G80 N81 W83 N99 R104
BS02 dna A K90 Y92 Q93 Y95 K97 S101 Y102 Y138 D143 S144 H147 Y152 Q166 K168 L183 Q187 K1 Y3 Q4 Y6 K8 S12 Y13 Y49 D54 S55 H58 Y63 Q77 K79 L94 Q98
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yz7, PDBe:7yz7, PDBj:7yz7
PDBsum7yz7
PubMed36435807
UniProtQ9I9E1|FOXH1_DANRE Forkhead box protein H1 (Gene Name=foxh1)

[Back to BioLiP]