Structure of PDB 7yw2 Chain A

Receptor sequence

>7yw2A (length=206) Species: 10090 (Mus musculus)

EQDRNVQLSKALSYALRHGALKLGLPMRADGFVPLQALLQLPQFHSFSIE
DVQLVVNTNEKQRFTLQPGEPSTGLLIRANQGHSLQVPELELTPLETPQA
LPLTLVHGTFWKHWPSILLKGLSRQGRTHIHLASGLPGDPGVISGIRPNC
EVAVFIDGPLALTDGIPFFCSANGVILTPGNAEGFLLPKYFKEALQLRPT
RKPLSL

3D structure

• PDB: 7yw2 Structural and biochemical insights into the molecular mechanism of TRPT1 for nucleic acid ADP-ribosylation.
• Chain: A
• Resolution: 2.23 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.160: 2'-phosphotransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HQG	A	R35 K79 R81 H125 T127 H131 S134 I135 L140 S141 Q143 R145 H149 G163 R165	R17 K61 R63 H107 T109 H113 S116 I117 L122 S123 Q125 R127 H131 G145 R147
BS02	GLY	A	L39 R46 A47	L21 R28 A29
BS03	GLY	A	Q71 L84	Q53 L66
BS04	GLY	A	T76 Q80	T58 Q62
BS05	GLY	A	E109 L110	E91 L92
BS06	GLY	A	S152 G192	S134 G174
BS07	SOR	A	H36 S102 G144	H18 S84 G126
BS08	SOR	A	V24 S27 N77 E78 R81	V6 S9 N59 E60 R63
BS09	GLY	A	Q54 A55 Q58	Q36 A37 Q40
BS10	GLY	A	K130 H131	K112 H113

Gene Ontology

Molecular Function

• GO:0000215 tRNA 2'-phosphotransferase activity
• GO:0016740 transferase activity

Biological Process

• GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
• GO:0008033 tRNA processing

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:7yw2, PDBe:7yw2, PDBj:7yw2
• PDBsum: 7yw2
• PubMed: 37334830
• UniProt: Q8K3A2|TRPT1_MOUSE tRNA 2'-phosphotransferase 1 (Gene Name=Trpt1)