Structure of PDB 7ytv Chain A

Receptor sequence

>7ytvA (length=317) Species: 746128 (Aspergillus fumigatus)

VHTKVVIIGSPAAHTAAIYLSRAELKPVLYEGMANQLTTTTDIENFPGFP
DGIGGAELMENMRKQSIRFGTEVITETISRVDLSSKPFKLWTEWNDGPDK
EPACTADAVIIATGANARRLNLPGEETYWQNGISACAVCDGAVPIFRNKP
LYVIGGGDSAAEEAMFLAKYGSSVTVLVRRDKLRASKAMAKRLLAHPKVT
VRFNTVATEVLGEKKPNGLMTHLRIKNTVTGEEEIVDANGLFYAVGHDPA
TALVKGQIDLDEDGYIITKPGTSYTSREGVFACGDVQDKRYRQAITSAGS
GCIAALEAEKFIAEAES

3D structure

• PDB: 7ytv In vitro antifungal and antibiofilm activities of auranofin against itraconazole-resistant Aspergillus fumigatus.
• Chain: A
• Resolution: 3.866 Å

Enzymatic activity

• Enzyme Commision number: 1.8.1.9: thioredoxin-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	G165 G166 D167 S168 R193 V254 G255	G156 G157 D158 S159 R184 V245 G246
BS02	FAD	A	S11 P13 Y32 E33 G34 A37 Q45 L46 T49 I52 T86 I87 A121 T122 G123 W138 Q139 S143 A144 C148 G293 D294 R301 Q302 A303 S306	S10 P11 Y30 E31 G32 A34 Q36 L37 T40 I43 T77 I78 A112 T113 G114 W129 Q130 S134 A135 C139 G284 D285 R292 Q293 A294 S297

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:7ytv, PDBe:7ytv, PDBj:7ytv
• PDBsum: 7ytv
• PubMed: 37037064
• UniProt: A0A229Y1X4