Structure of PDB 7yrd Chain A

Receptor sequence
>7yrdA (length=100) Species: 8355 (Xenopus laevis) [Search protein sequence]
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQ
SSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB7yrd Structural insight into H4K20 methylation on H2A.Z-nucleosome by SUV420H1.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R40 R42 T45 R72 R83 F84 S86 R116 V117 T118 R5 R7 T10 R37 R48 F49 S51 R81 V82 T83
BS02 dna A K37 R40 Y41 V46 A47 R49 L65 P66 R69 R83 K2 R5 Y6 V11 A12 R14 L30 P31 R34 R48
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7yrd, PDBe:7yrd, PDBj:7yrd
PDBsum7yrd
PubMed37536340
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]