Structure of PDB 7ykd Chain A

Receptor sequence

>7ykdA (length=282) Species: 9606 (Homo sapiens) [Search protein sequence]

LEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMKKTVNMVWFLNLAV
ADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTII
SSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANL
HGKISCFNNFSLSDPVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCK
LQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSL
GLPLATALAIANSCMNPILYVFMGQDFKKFKV

3D structure

PDB

7ykd Cryo-EM structure of the human chemerin receptor 1-Gi protein complex bound to the C-terminal nonapeptide of chemerin.

Chain

Resolution

2.81 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	H95 Y103 N116 L119 I120 M123 R178 L183 C189 F190 N191 R224 E283 H286 F294 S295 L298	H62 Y70 N83 L86 I87 M90 R145 L150 C156 F157 N158 R178 E237 H240 F248 S249 L252
BS02	CLR	A	S135 I139 L143 W146	S102 I106 L110 W113
BS03	CLR	A	M158 A159	M125 A126
BS04	CLR	A	N80 F117 L118 Y157 M161	N47 F84 L85 Y124 M128
BS05	CLR	A	K260 I261 M311 I314	K214 I215 M265 I268

Gene Ontology

	Molecular Function
GO:0004875	complement receptor activity
GO:0004930	G protein-coupled receptor activity
GO:0004950	chemokine receptor activity
GO:0005515	protein binding
GO:0038023	signaling receptor activity
GO:0097003	adipokinetic hormone receptor activity
GO:0097004	adipokinetic hormone binding

	Biological Process
GO:0001501	skeletal system development
GO:0002430	complement receptor mediated signaling pathway
GO:0006935	chemotaxis
GO:0006954	inflammatory response
GO:0006955	immune response
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204	positive regulation of cytosolic calcium ion concentration
GO:0010759	positive regulation of macrophage chemotaxis
GO:0032088	negative regulation of NF-kappaB transcription factor activity
GO:0032695	negative regulation of interleukin-12 production
GO:0045600	positive regulation of fat cell differentiation
GO:0050848	regulation of calcium-mediated signaling
GO:0070098	chemokine-mediated signaling pathway
GO:0120162	positive regulation of cold-induced thermogenesis

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ykd, PDBe:7ykd, PDBj:7ykd
PDBsum	7ykd
PubMed	36881626
UniProt	Q99788\|CML1_HUMAN Chemerin-like receptor 1 (Gene Name=CMKLR1)

[Back to BioLiP]