Structure of PDB 7ygy Chain A

Receptor sequence

>7ygyA (length=99) Species: 9606 (Homo sapiens)

PYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHL
GLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEI

3D structure

• PDB: 7ygy Structural and biochemical insights into Zn 2+ -bound EF-hand proteins, EFhd1 and EFhd2.
• Chain: A
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	D141 D143 D145 E152	D60 D62 D64 E71
BS02	ZN	A	H130 K134	H49 K53
BS03	ZN	A	D105 D109 F111 E116	D24 D28 F30 E35

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding

External links

• PDB: RCSB:7ygy, PDBe:7ygy, PDBj:7ygy
• PDBsum: 7ygy
• PubMed: 36862489
• UniProt: Q96C19|EFHD2_HUMAN EF-hand domain-containing protein D2 (Gene Name=EFHD2)