Structure of PDB 7yf2 Chain A

Receptor sequence

>7yf2A (length=275) Species: 9606 (Homo sapiens)

HMAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSG
WAAIQAYHSAVSSAFSLAMSRTSINGLLGRGSMFVFSPDQFQRLLKINPD
WKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGI
NEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLP
FHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRL
PYLCEGDMYNDYYVLDDAVFVLKPV

3D structure

• PDB: 7yf2 Molecular basis for METTL9-mediated N1-histidine methylation
• Chain: A
• Resolution: 1.691 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	N118 R123 G124 M126 N210 D213 R214 V241 L242 P243 H245 Y247 Q267 N268 W269 Q272 Y295 C297 D300 Y302 Y306 L308	N75 R80 G81 M83 N167 D170 R171 V198 L199 P200 H202 Y204 Q224 N225 W226 Q229 Y252 C254 D257 Y259 Y263 L265
BS02	SAH	A	G153 E174 L175 L209 N210 L211 Y295	G110 E131 L132 L166 N167 L168 Y252

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0106370 protein-L-histidine N-pros-methyltransferase activity

Biological Process

• GO:0032259 methylation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005783 endoplasmic reticulum

External links

• PDB: RCSB:7yf2, PDBe:7yf2, PDBj:7yf2
• PDBsum: 7yf2
• PubMed: 37015930
• UniProt: Q9H1A3|METL9_HUMAN Protein-L-histidine N-pros-methyltransferase (Gene Name=METTL9)