Structure of PDB 7yb7 Chain A

Receptor sequence

>7yb7A (length=136) Species: 9606 (Homo sapiens)

DNREIVMKYISYKLSQRGYEWESEVVHQTLRQAGDDFSLRYRRDFAEMSS
QLHLTPGTAYASFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
VLVDNIAAWMATYLNDHLHTWIQDNGGWDAFVELYG

3D structure

• PDB: 7yb7 Cyclic peptides discriminate BCL-2 and its clinical mutants from BCL-XL by engaging a single-residue discrepancy
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Y58 D61 F62 E86 L87 D90 N93 G95 R96 A99 L151 Y152	Y41 D44 F45 E69 L70 D73 N76 G78 R79 A82 L134 Y135
BS02	IQ8	A	G91 V92 N93 W94 R96 L151	G74 V75 N76 W77 R79 L134
BS03	IQ8	A	P73 N122	P56 N105

Gene Ontology

Biological Process

• GO:0042981 regulation of apoptotic process

External links

• PDB: RCSB:7yb7, PDBe:7yb7, PDBj:7yb7
• PDBsum: 7yb7
• PubMed: 38368459
• UniProt: P10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2);
  Q07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)