Structure of PDB 7y9c Chain A

Receptor sequence

>7y9cA (length=274) Species: 9606 (Homo sapiens)

MAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGW
AAIQAYHSAVSSAFSLAMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDW
KTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGIN
EWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPF
HPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLP
YLCEGDMYNDYYVLDDAVFVLKPV

3D structure

• PDB: 7y9c Molecular basis for METTL9-mediated N1-histidine methylation
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	N118 G124 M126 N210 D213 R214 P243 H245 Q267 N268 W269 Q272 Y295 C297 D300 Y302 Y306 L308	N74 G80 M82 N166 D169 R170 P199 H201 Q223 N224 W225 Q228 Y251 C253 D256 Y258 Y262 L264
BS02	SAH	A	G153 E174 L175 L209 N210 L211 R214 Y295	G109 E130 L131 L165 N166 L167 R170 Y251

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0106370 protein-L-histidine N-pros-methyltransferase activity

Biological Process

• GO:0032259 methylation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005783 endoplasmic reticulum

External links

• PDB: RCSB:7y9c, PDBe:7y9c, PDBj:7y9c
• PDBsum: 7y9c
• PubMed: 37015930
• UniProt: Q9H1A3|METL9_HUMAN Protein-L-histidine N-pros-methyltransferase (Gene Name=METTL9)