Structure of PDB 7y7w Chain A

Receptor sequence
>7y7wA (length=529) Species: 9606 (Homo sapiens) [Search protein sequence]
GRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLF
LLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIISWAI
YYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMH
QMTDGLDKPGQIRWPLAITLAIAWILVYFCIWKGVGWTGKVVYFSATYPY
IMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGL
GLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHV
TKRSIADVAASGPGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQF
CTVEGFITALVDEYPRLLRNRRELFIAAVCIISYLIGLSNITQGGIYVFK
LFDYYSASGMSLLFLVFFECVSISWFYGVNRFYDNIQEMVGSRPCIWWKL
CWSFFTPIIVAGVFIFSAVQMTPLTMGNYVFPKWGQGVGWLMALSSMVLI
PGYMAYMFLTLKGSLKQRIQVMVQPSEDI
3D structure
PDB7y7w Molecular basis for substrate recognition and transport of human GABA transporter GAT1.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ABU A Y60 A61 G63 G65 S295 Y12 A13 G15 G17 S247
BS02 NA A A61 I62 N66 S295 N327 A13 I14 N18 S247 N279
BS03 NA A G59 I62 G63 L392 D395 S396 G11 I14 G15 L344 D347 S348
Gene Ontology
Molecular Function
GO:0005332 gamma-aminobutyric acid:sodium:chloride symporter activity
GO:0005515 protein binding
GO:0015185 gamma-aminobutyric acid transmembrane transporter activity
GO:0015293 symporter activity
GO:0015378 sodium:chloride symporter activity
GO:0022857 transmembrane transporter activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006836 neurotransmitter transport
GO:0006865 amino acid transport
GO:0007268 chemical synaptic transmission
GO:0007612 learning
GO:0007613 memory
GO:0008306 associative learning
GO:0009636 response to toxic substance
GO:0009744 response to sucrose
GO:0010288 response to lead ion
GO:0014054 positive regulation of gamma-aminobutyric acid secretion
GO:0014070 response to organic cyclic compound
GO:0014074 response to purine-containing compound
GO:0032229 negative regulation of synaptic transmission, GABAergic
GO:0032355 response to estradiol
GO:0035725 sodium ion transmembrane transport
GO:0042220 response to cocaine
GO:0050808 synapse organization
GO:0051592 response to calcium ion
GO:0051936 gamma-aminobutyric acid reuptake
GO:0051939 gamma-aminobutyric acid import
GO:0098658 inorganic anion import across plasma membrane
GO:0098719 sodium ion import across plasma membrane
GO:0098810 neurotransmitter reuptake
GO:0150104 transport across blood-brain barrier
GO:1902476 chloride transmembrane transport
GO:1904313 response to methamphetamine hydrochloride
Cellular Component
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0030424 axon
GO:0042734 presynaptic membrane
GO:0042995 cell projection
GO:0043025 neuronal cell body
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0098793 presynapse
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y7w, PDBe:7y7w, PDBj:7y7w
PDBsum7y7w
PubMed37400655
UniProtP30531|SC6A1_HUMAN Sodium- and chloride-dependent GABA transporter 1 (Gene Name=SLC6A1)

[Back to BioLiP]