Structure of PDB 7y4a Chain A

Receptor sequence

>7y4aA (length=181) Species: 9606 (Homo sapiens) [Search protein sequence]

MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRT
VNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPE
VCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIH
AVRYLECSALQQDGVKEVFAEAVRAVLNPTP

3D structure

PDB

7y4a Targeting Ras-binding domain of ELMO1 by computational nanobody design.

Chain

Resolution

1.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	T17 T35	T17 T35
BS02	GDP	A	A13 G15 K16 T17 C18 F28 Y32 K116 D118 L119 S158 L160	A13 G15 K16 T17 C18 F28 Y32 K116 D118 L119 S158 L160

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0019901	protein kinase binding

	Biological Process
GO:0007015	actin filament organization
GO:0007163	establishment or maintenance of cell polarity
GO:0007264	small GTPase-mediated signal transduction
GO:0007266	Rho protein signal transduction
GO:0008284	positive regulation of cell population proliferation
GO:0008360	regulation of cell shape
GO:0016601	Rac protein signal transduction
GO:0030036	actin cytoskeleton organization
GO:0030865	cortical cytoskeleton organization
GO:0032956	regulation of actin cytoskeleton organization
GO:0045893	positive regulation of DNA-templated transcription
GO:0060326	cell chemotaxis
GO:0090630	activation of GTPase activity
GO:0150052	regulation of postsynapse assembly
GO:1900027	regulation of ruffle assembly
GO:1903078	positive regulation of protein localization to plasma membrane

	Cellular Component
GO:0005789	endoplasmic reticulum membrane
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0005925	focal adhesion
GO:0030667	secretory granule membrane
GO:0031410	cytoplasmic vesicle
GO:0042995	cell projection
GO:0070062	extracellular exosome
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y4a, PDBe:7y4a, PDBj:7y4a
PDBsum	7y4a
PubMed	36932164
UniProt	P84095\|RHOG_HUMAN Rho-related GTP-binding protein RhoG (Gene Name=RHOG)

[Back to BioLiP]