Structure of PDB 7xxk Chain A |
>7xxkA (length=109) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] |
KKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIA QFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNK HIDAYKTFP |
|
PDB | 7xxk Crystal structure of SARS-CoV-2 N-CTD in complex with GMP |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5GP |
A |
R259 T282 W330 |
R4 T27 W75 |
|
|
|
|