Structure of PDB 7xwg Chain A

Receptor sequence

>7xwgA (length=72) Species: 3702 (Arabidopsis thaliana)

RSGVCGSVWGQNDIAYRCRTCENDPTCAICVPCFQNGDHNSHDYSIIYTG
GGCCDCGDETAWKPDGFCSNHK

3D structure

• PDB: 7xwg Structural analyses of plant PRT6-UBR box for Cys-Arg/N-degron pathway and insights into the plant submergence resistance
• Chain: A
• Resolution: 1.832 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C149 C172 C184 H187	C33 C56 C68 H71
BS02	ZN	A	C121 C146 C149 C170	C5 C30 C33 C54
BS03	ZN	A	C134 C137 H155 H158	C18 C21 H39 H42

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0061630 ubiquitin protein ligase activity

Biological Process

• GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

External links

• PDB: RCSB:7xwg, PDBe:7xwg, PDBj:7xwg
• PDBsum: 7xwg
• UniProt: F4KCC2|PRT6_ARATH E3 ubiquitin-protein ligase PRT6 (Gene Name=PRT6)