Structure of PDB 7xv8 Chain A

Receptor sequence
>7xv8A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence]
VVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIIN
KHHRNRCQFCRLKKCLEMGMKMESVQS
3D structure
PDB7xv8 Structures of human TR4LBD-JAZF1 and TR4DBD-DNA complexes reveal the molecular basis of transcriptional regulation.
ChainA
Resolution3.199 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R127 H128 Y129 K142 Q188 R15 H16 Y17 K30 Q76
BS02 dna A E135 G136 R143 R166 N167 Q170 E23 G24 R31 R54 N55 Q58
BS03 ZN A C117 C120 C134 C137 C5 C8 C22 C25
BS04 ZN A C153 C159 C169 C172 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xv8, PDBe:7xv8, PDBj:7xv8
PDBsum7xv8
PubMed36651297
UniProtP49116|NR2C2_HUMAN Nuclear receptor subfamily 2 group C member 2 (Gene Name=NR2C2)

[Back to BioLiP]