Structure of PDB 7xp7 Chain A

Receptor sequence

>7xp7A (length=369) Species: 457430 (Streptomyces filamentosus NRRL 11379)

ENQRWRERIRHFAEKEIAPLSTTMDRTATLDAGLRERLFAEGLMSVEIPR
GYGGTGGTLCQLILTIEEVARVDPGVAVGVHVHNVLVAGTLLRHASGDQR
RQYLPQLATGKIGAFALSEEQAGSDAFALTTVARQDEGGYLLTGRKRWTS
NARNADLLLVFALADGGPTAFVVPADAPGVSLDDRVEQMGVRAAATSDVI
FDGTPVRTAQRVGPPGGGQTVALSGLGLGRLGIAAQMTGLAQGALDAATG
YSRVREQFGGRIADHQGVAFPLADVASRLAAARALLYRAVDLHGRGTDPV
ELMRLAAMAKYVASEVAERAASVAVETLGGNGYTDAYPVERFYRDAKAGK
IYEGTSNVLLRTIASIMIG

3D structure

• PDB: 7xp7 Structure-Based Mechanistic Insights into ColB1, a Flavoprotein Functioning in-trans in the 2,2'-Bipyridine Assembly Line for Cysteine Dehydrogenation.
• Chain: A
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	F154 L156 S157 G162 S163 W187 S189 I391 Y392 T395 N397	F115 L117 S118 G123 S124 W148 S150 I351 Y352 T355 N357
BS02	FAD	A	R295 F298 I302 H305 V308 E366 T367 G370 Y373	R255 F258 I262 H265 V268 E326 T327 G330 Y333

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 04:50:15 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7xp7', asym_id = 'A', title = 'Structure-Based Mechanistic Insights into ColB1,...dine Assembly Line for Cysteine Dehydrogenation. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7xp7', asym_id='A', title='Structure-Based Mechanistic Insights into ColB1,...dine Assembly Line for Cysteine Dehydrogenation. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003995,0016627,0050660', uniprot = '', pdbid = '7xp7', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003995,0016627,0050660', uniprot='', pdbid='7xp7', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>