Structure of PDB 7xgj Chain A

Receptor sequence

>7xgjA (length=168) Species: 9606 (Homo sapiens)

MYNFFPRKPKWDKNQITYRIIGYTPDLAPETVDDAFARAFQVWSDVTPLR
FSRIYDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFD
DDELWTLGKGVGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFR
LSQDDIKGIQELYGASPD

3D structure

• PDB: 7xgj Discovery of Aryloxyphenyl-Heptapeptide Hybrids as Potent and Selective Matrix Metalloproteinase-2 Inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis.
• Chain: A
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 3.4.24.24: gelatinase A.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	F5 L83 H85 A86 F87 H121 H125 H131 L138 A140 I142 Y143 T144	F5 L83 H85 A86 F87 H121 H125 H131 L138 A140 I142 Y143 T144
BS02	ZN	A	H121 H125 H131	H121 H125 H131
BS03	ZN	A	H70 D72 H85 H98	H70 D72 H85 H98
BS04	CA	A	D77 G78 D80 L82 D100 E103	D77 G78 D80 L82 D100 E103
BS05	CA	A	D60 G92 G94 D96	D60 G92 G94 D96
BS06	CA	A	D26 D101 E103	D26 D101 E103
BS07	CA	A	R67 E69	R67 E69

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:7xgj, PDBe:7xgj, PDBj:7xgj
• PDBsum: 7xgj
• PubMed: 35687819
• UniProt: P08253|MMP2_HUMAN 72 kDa type IV collagenase (Gene Name=MMP2)