Structure of PDB 7x73 Chain A

Receptor sequence

>7x73A (length=274) Species: 9606 (Homo sapiens)

RTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDR
NITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFE
CNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICE
YVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCD
PNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYF
TCQCGSEKCKHSAEAIALEQSRLA

3D structure

• PDB: 7x73 A specific G9a inhibitor unveils BGLT3 lncRNA as a universal mediator of chemically induced fetal globin gene expression.
• Chain: A
• Resolution: 1.49 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C974 C987 C1017 C1021	C58 C71 C101 C105
BS02	ZN	A	C980 C1017 C1023 C1027	C64 C101 C107 C111
BS03	ZN	A	C974 C976 C980 C985	C58 C60 C64 C69
BS04	ZN	A	C1115 C1168 C1170 C1175	C199 C252 C254 C259
BS05	SFG	A	M1048 W1050 S1084 Y1085 R1109 F1110 N1112 H1113 Y1154 F1166 C1168 Q1169	M132 W134 S168 Y169 R193 F194 N196 H197 Y238 F250 C252 Q253
BS06	J26	A	D1083 L1086 F1087 D1088 R1123 F1152 Y1154 R1157 F1158 I1161	D167 L170 F171 D172 R207 F236 Y238 R241 F242 I245

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7x73, PDBe:7x73, PDBj:7x73
• PDBsum: 7x73
• PubMed: 36635268
• UniProt: Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)