Structure of PDB 7x2b Chain A

Receptor sequence
>7x2bA (length=217) Species: 1789172 (Diadumene lineata) [Search protein sequence]
MSLIKDQMTTKLHLEGTVNGHYFEIEGNGQGEPYEGKQSMKLVVTKGAPL
PFAYDILLPQHSKPFIKYPAEIPDYYKQSFPEGFSWERIMKFEDGAVCTV
SQHSSLKGNCFVYDVKFHGVHFPLDGPVMQKKTLGWEPSTERIYPRDGML
RGDVPMALKVEGGGNYRCDFKTVYKAKKSVKLPENHFVDHRIVMTKHDKD
YTNVEQAEVAVARNSPF
3D structure
PDB7x2b Orange and red fluorescent proteins from Diadumene lineata
ChainA
Resolution1.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NRQ A Q38 P59 H61 S65 K66 W89 R91 S142 M159 H193 I195 Q209 E211 Q38 P59 H61 S62 K63 W86 R88 S139 M156 H190 I192 Q206 E208
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 06:49:07 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7x2b', asym_id = 'A', title = 'Orange and red fluorescent proteins from Diadumene lineata'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7x2b', asym_id='A', title='Orange and red fluorescent proteins from Diadumene lineata')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006091,0008218', uniprot = '', pdbid = '7x2b', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006091,0008218', uniprot='', pdbid='7x2b', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>