Structure of PDB 7wv3 Chain A

Receptor sequence
>7wv3A (length=668) Species: 9606 (Homo sapiens) [Search protein sequence]
TVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLT
SLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTEL
HLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLL
SNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFL
NNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTM
LDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLN
LKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGL
INLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFS
WLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFAL
VPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEG
LEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIP
VEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKK
VFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCN
TPPHYHGFPVRLFDTSSC
3D structure
PDB7wv3 TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
ChainA
Resolution2.26 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A N517 H539 N541 G573 N489 H511 N513 G545
BS02 rna A H39 K41 Q62 A519 R544 K619 H11 K13 Q34 A491 R516 K591
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0004888 transmembrane signaling receptor activity
GO:0005515 protein binding
GO:0038023 signaling receptor activity
GO:0038187 pattern recognition receptor activity
GO:0042802 identical protein binding
GO:0044389 ubiquitin-like protein ligase binding
Biological Process
GO:0000165 MAPK cascade
GO:0001774 microglial cell activation
GO:0002224 toll-like receptor signaling pathway
GO:0002730 regulation of dendritic cell cytokine production
GO:0006952 defense response
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0006972 hyperosmotic response
GO:0007165 signal transduction
GO:0007250 activation of NF-kappaB-inducing kinase activity
GO:0007252 I-kappaB phosphorylation
GO:0007254 JNK cascade
GO:0008584 male gonad development
GO:0009597 detection of virus
GO:0009615 response to virus
GO:0010628 positive regulation of gene expression
GO:0032481 positive regulation of type I interferon production
GO:0032722 positive regulation of chemokine production
GO:0032727 positive regulation of interferon-alpha production
GO:0032728 positive regulation of interferon-beta production
GO:0032729 positive regulation of type II interferon production
GO:0032735 positive regulation of interleukin-12 production
GO:0032755 positive regulation of interleukin-6 production
GO:0032757 positive regulation of interleukin-8 production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0034138 toll-like receptor 3 signaling pathway
GO:0034343 type III interferon production
GO:0034346 positive regulation of type III interferon production
GO:0035458 cellular response to interferon-beta
GO:0042742 defense response to bacterium
GO:0043065 positive regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043330 response to exogenous dsRNA
GO:0043331 response to dsRNA
GO:0045087 innate immune response
GO:0045671 negative regulation of osteoclast differentiation
GO:0045766 positive regulation of angiogenesis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046330 positive regulation of JNK cascade
GO:0050729 positive regulation of inflammatory response
GO:0051607 defense response to virus
GO:0060907 positive regulation of macrophage cytokine production
GO:0071260 cellular response to mechanical stimulus
GO:0071346 cellular response to type II interferon
GO:0071360 cellular response to exogenous dsRNA
GO:0071466 cellular response to xenobiotic stimulus
GO:0090594 inflammatory response to wounding
GO:0097191 extrinsic apoptotic signaling pathway
GO:0097527 necroptotic signaling pathway
GO:0098586 cellular response to virus
GO:1900017 positive regulation of cytokine production involved in inflammatory response
GO:1901224 positive regulation of non-canonical NF-kappaB signal transduction
Cellular Component
GO:0000139 Golgi membrane
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005768 endosome
GO:0005769 early endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0031012 extracellular matrix
GO:0036020 endolysosome membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wv3, PDBe:7wv3, PDBj:7wv3
PDBsum7wv3
PubMed36371424
UniProtO15455|TLR3_HUMAN Toll-like receptor 3 (Gene Name=TLR3)

[Back to BioLiP]