Structure of PDB 7wul Chain A

Receptor sequence

>7wulA (length=70) Species: 39947 (Oryza sativa Japonica Group)

AVCGSVWGQNDLAYRCRTCEHDPTCAICVPCFQNGNHKDHDYSIMYTGGG
CCDCGDTTAWKREGFCSRHK

3D structure

• PDB: 7wul Crystal structure of UBR box from PRT6
• Chain: A
• Resolution: 1.58 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	R134 D141 T143 T166 G167 G168 G169 C170 D172 A178	R15 D22 T24 T47 G48 G49 G50 C51 D53 A59
BS02	ZN	A	C150 C173 C185 H188	C31 C54 C66 H69
BS03	ZN	A	C122 C147 C150 C171	C3 C28 C31 C52
BS04	ZN	A	C135 C138 H156 H159	C16 C19 H37 H40

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0061630 ubiquitin protein ligase activity

Biological Process

• GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

External links

• PDB: RCSB:7wul, PDBe:7wul, PDBj:7wul
• PDBsum: 7wul
• UniProt: A0A0P0UY23