Structure of PDB 7wt2 Chain A

Receptor sequence
>7wt2A (length=183) Species: 9606 (Homo sapiens) [Search protein sequence]
AEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTR
VLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLEL
THNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVK
KPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
3D structure
PDB7wt2 Crystal structures of human glyoxalase I and its complex with TLSC702 reveal inhibitor binding mode and substrate preference.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 4.4.1.5: lactoylglutathione lyase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H126 E172 H126 E172
BS02 5ZO A H126 M157 L160 F162 E172 M179 H126 M157 L160 F162 E172 M179
BS03 ZN A Q33 E99 Q33 E99
BS04 5ZO A C60 L69 F71 L92 E99 C60 L69 F71 L92 E99
Gene Ontology
Molecular Function
GO:0004462 lactoylglutathione lyase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016829 lyase activity
GO:0046872 metal ion binding
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006749 glutathione metabolic process
GO:0009438 methylglyoxal metabolic process
GO:0030316 osteoclast differentiation
GO:0043066 negative regulation of apoptotic process
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wt2, PDBe:7wt2, PDBj:7wt2
PDBsum7wt2
PubMed35363883
UniProtQ04760|LGUL_HUMAN Lactoylglutathione lyase (Gene Name=GLO1)

[Back to BioLiP]