Structure of PDB 7wsm Chain A

Receptor sequence
>7wsmA (length=464) Species: 9606 (Homo sapiens) [Search protein sequence]
TGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPS
SIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRG
ALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLL
PFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERE
RPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVG
QPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVA
LLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPE
TRGRTFDQISAAFH
3D structure
PDB7wsm Cryo-EM structure of human glucose transporter GLUT4.
ChainA
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 5RH A S153 Q177 I180 Q298 Q299 F307 W404 N427 S133 Q157 I160 Q278 Q279 F287 W384 N407
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015304 D-glucose uniporter activity
GO:0022857 transmembrane transporter activity
GO:0055056 D-glucose transmembrane transporter activity
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0007611 learning or memory
GO:0007614 short-term memory
GO:0007616 long-term memory
GO:0010021 amylopectin biosynthetic process
GO:0031550 positive regulation of brain-derived neurotrophic factor receptor signaling pathway
GO:0032869 cellular response to insulin stimulus
GO:0042593 glucose homeostasis
GO:0044381 glucose import in response to insulin stimulus
GO:0045471 response to ethanol
GO:0046323 D-glucose import
GO:0050873 brown fat cell differentiation
GO:0055085 transmembrane transport
GO:0070343 white fat cell proliferation
GO:0070837 dehydroascorbic acid transport
GO:0071356 cellular response to tumor necrosis factor
GO:0071456 cellular response to hypoxia
GO:0071470 cellular response to osmotic stress
GO:0098694 regulation of synaptic vesicle budding from presynaptic endocytic zone membrane
GO:0150104 transport across blood-brain barrier
GO:1904659 D-glucose transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005771 multivesicular body
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0012505 endomembrane system
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0016529 sarcoplasmic reticulum
GO:0030136 clathrin-coated vesicle
GO:0030140 trans-Golgi network transport vesicle
GO:0030315 T-tubule
GO:0030659 cytoplasmic vesicle membrane
GO:0031982 vesicle
GO:0032593 insulin-responsive compartment
GO:0042383 sarcolemma
GO:0045121 membrane raft
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0098793 presynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wsm, PDBe:7wsm, PDBj:7wsm
PDBsum7wsm
PubMed35562357
UniProtP14672|GLUT4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 (Gene Name=SLC2A4)

[Back to BioLiP]