Structure of PDB 7wkv Chain A

Receptor sequence

>7wkvA (length=219) Species: 9606 (Homo sapiens)

QQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHT
VDRAPLRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVI
QKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSD
SALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDI
KERRAVIILRKTRLDAPRL

3D structure

• PDB: 7wkv Mechanisms of substrate recognition and N6-methyladenosine demethylation revealed by crystal structures of ALKBH5-RNA complexes.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.53: mRNA N(6)-methyladenine demethylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P128 L129 R130 Y139 Y141 G142 R148 E153 I201 V202 S203 H204 V205 D206 F234 I237	P55 L56 R57 Y66 Y68 G69 R75 E80 I128 V129 S130 H131 V132 D133 F161 I164
BS02	MN	A	H204 D206 H266	H131 D133 H193
BS03	AKG	A	N193 Y195 H204 H266 I268 R277 V279 I281 R283	N120 Y122 H131 H193 I195 R204 V206 I208 R210

Gene Ontology

Molecular Function

• GO:0035515 oxidative RNA demethylase activity

Biological Process

• GO:0006397 mRNA processing

External links

• PDB: RCSB:7wkv, PDBe:7wkv, PDBj:7wkv
• PDBsum: 7wkv
• PubMed: 35333330
• UniProt: Q6P6C2|ALKB5_HUMAN RNA demethylase ALKBH5 (Gene Name=ALKBH5)