Structure of PDB 7wkp Chain A

Receptor sequence

>7wkpA (length=167) Species: 1296592 (Vibrio phage ICP1_2011_A)

MYNTISITVVDADDVGVNFVVSKVLSTLHNKGIFNGEVGVTFPRMDKNVG
DIITLFSKTGVDRKVLTSTLNTLTDFIHIGKPKEADKVKTYRKVDTKSKG
KLIRRCIKRKGVSAETAESLYGNYKGEKCKLPYIVVNSKSTGQRFSMFLE
ECENSEKFNSYGLCIVS

3D structure

• PDB: 7wkp Mechanistic insights into DNA binding and cleavage by a compact type I-F CRISPR-Cas system in bacteriophage.
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	N39 H50 K68 N69 R113 K114 D116 T117 K118 S119 K122 L123 R125 R126 R130 K131 L141 Y142 Y145 K151 L152 P153 Y154 S159 K160 S161 T162 Q164 F166 S167 F169 N180 S181 Y182 I186 V187	N18 H29 K47 N48 R92 K93 D95 T96 K97 S98 K101 L102 R104 R105 R109 K110 L120 Y121 Y124 K130 L131 P132 Y133 S138 K139 S140 T141 Q143 F145 S146 F148 N159 S160 Y161 I165 V166

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
• GO:0050660 flavin adenine dinucleotide binding

Biological Process

• GO:0043571 maintenance of CRISPR repeat elements

External links

• PDB: RCSB:7wkp, PDBe:7wkp, PDBj:7wkp
• PDBsum: 7wkp
• PubMed: 37094126
• UniProt: M1R9H3