Structure of PDB 7wkg Chain A

Receptor sequence

>7wkgA (length=133) Species: 9606 (Homo sapiens) [Search protein sequence]

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDIL
TLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDG
QETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

3D structure

PDB

7wkg The 0.84 angstrom X-ray structure of the human heart fatty acid-binding protein complexed with erucic acid

Chain

Resolution

0.84 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	08O	A	M20 A33 T53 F57 K58 A75 L115 R126 Y128	M21 A34 T54 F58 K59 A76 L116 R127 Y129

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008092	cytoskeletal protein binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0070538	oleic acid binding

	Biological Process
GO:0008285	negative regulation of cell population proliferation
GO:0015909	long-chain fatty acid transport
GO:0032365	intracellular lipid transport
GO:0042632	cholesterol homeostasis
GO:0046320	regulation of fatty acid oxidation
GO:0050873	brown fat cell differentiation
GO:0055091	phospholipid homeostasis
GO:0071073	positive regulation of phospholipid biosynthetic process
GO:0140214	positive regulation of long-chain fatty acid import into cell
GO:2001245	regulation of phosphatidylcholine biosynthetic process

External links

PDB	RCSB:7wkg, PDBe:7wkg, PDBj:7wkg
PDBsum	7wkg
PubMed
UniProt	P05413\|FABPH_HUMAN Fatty acid-binding protein, heart (Gene Name=FABP3)