Structure of PDB 7wju Chain A

Receptor sequence

>7wjuA (length=407) Species: 1765684 (Sulfoacidibacillus thermotolerans)

MIKVYRYEIVKPLDLDWKEFGTILRQLQQETRFALNKATQLAWEWMGFSS
DYKDNHGEYPKSKDILGYTNVHGYAYHTIKTKAYRLNSGNLSQTIKRATD
RFKAYQKEILRGDMSIPSYKRDIPLDLIKENISVNRMNHGDYIASLSLLS
NPAKQEMNVKRKISVIIIVRGAGKTIMDRILSGEYQVSASQIIHDDRKNK
WYLNISYDFEPQTRVLDLNKIMGIALGVAVAVYMAFQHTPARYKLEGGEI
ENFRRQVESRRISMGGHGRDKRIKPIEQLRDKIANFRDTTNHRYSRYIVD
MAIKEGCGTIQMEDLTNIRDIGSRFLQNWTYYDLQQKIIYKAEEAGIKVI
KIDPQYTSQRCSECGNIDSGNRIGQAIFKCRACGYEANADYNAARNIAIP
NIDKIIA

3D structure

• PDB: 7wju Structure-directed functional evolution of the miniature CRISPR-AsCas12f1 system
• Chain: A
• Resolution: 2.69 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K3 V4 Y5 R6 E8 K11 D16 W17 R101 M114 S115 P117 S118 Y119 K120 P124 R136 H139 R170 G171 Q191 K198 K200 Y202 G277 H278 G279 R280 R283 N296 T300 H303 R304 R307 Y351	K3 V4 Y5 R6 E8 K11 D16 W17 R101 M114 S115 P117 S118 Y119 K120 P124 R136 H139 R170 G171 Q191 K198 K200 Y202 G266 H267 G268 R269 R272 N285 T289 H292 R293 R296 Y340
BS02	dna	A	I2 K96 K129 S188 A189 R280 R291 R298 T341 Y342 Y343	I2 K96 K129 S188 A189 R269 R280 R287 T330 Y331 Y332
BS03	dna	A	Y68 T69 H72 Y76 S88 S92 S147 S150 N151	Y68 T69 H72 Y76 S88 S92 S147 S150 N151

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:7wju, PDBe:7wju, PDBj:7wju
• PDBsum: 7wju
• UniProt: A0A2U3D0N8|CS12F_SULT2 CRISPR-associated endodeoxyribonuclease Cas12f1 (Gene Name=cas12f1)