Structure of PDB 7wgp Chain A

Receptor sequence

>7wgpA (length=269) Species: 9606 (Homo sapiens)

MQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTSPFVIYDMNS
LMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIP
GFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLK
SLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVK
PIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQ
VIKKTSLHPLLQEIYKDLY

3D structure

• PDB: 7wgp Functional and Structural Insights into Human PPAR alpha / delta / gamma Subtype Selectivity of Bezafibrate, Fenofibric Acid, and Pemafibrate.
• Chain: A
• Resolution: 2.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K301 L311 L318 K319 P467 L468 E471	K97 L107 L114 K115 P259 L260 E263
BS02	F5A	A	A278 I281 F282 S289 H323 F360 F363 M364 H449 L469 Y473	A74 I77 F78 S85 H119 F156 F159 M160 H245 L261 Y265
BS03	F5A	A	C285 R288 I326 L330 M364	C81 R84 I122 L126 M160
BS04	F5A	A	L255 E259 F264 K265 R280 G284 R288 S342 M348	L51 E55 F60 K61 R76 G80 R84 S138 M144

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004879 nuclear receptor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7wgp, PDBe:7wgp, PDBj:7wgp
• PDBsum: 7wgp
• PubMed: 35563117
• UniProt: P37231|PPARG_HUMAN Peroxisome proliferator-activated receptor gamma (Gene Name=PPARG)